This information is for educational purposes only and does not constitute medical advice.

LL-37

Also known as: Cathelicidin, hCAP-18

A human antimicrobial peptide of the cathelicidin family, studied for its broad-spectrum antimicrobial and immunomodulatory properties.

Limited Human Data
Research Only

Quick Facts

Sequence
[LL-37, 37 aa]
Molecular Weight
4493.37 Da

Overview

LL-37 is the only cathelicidin-derived antimicrobial peptide found in humans. It is a 37-amino acid peptide cleaved from the C-terminus of the human cathelicidin antimicrobial protein hCAP-18. It is expressed by various cell types including neutrophils, epithelial cells, and macrophages.

Research interest in LL-37 spans antimicrobial applications, wound healing, immune modulation, and potential anti-cancer properties.

Mechanism of Action

LL-37 disrupts microbial membranes through electrostatic interactions with negatively charged phospholipids. Beyond direct antimicrobial action, it acts as an immune modulator by binding to formyl peptide receptor-like 1 (FPRL1), promoting angiogenesis, and modulating inflammatory cytokine production. It also has chemotactic properties for various immune cells.

Biological Pathways

Innate ImmunityMembrane DisruptionChemotaxisAngiogenesis

Research Findings

Limited Human Data

In vitro studies demonstrate broad-spectrum activity against bacteria, fungi, and enveloped viruses. Animal models show efficacy in wound healing and infection control. Early-phase human trials have explored topical applications for chronic wounds and venous leg ulcers. Some studies suggest anti-biofilm properties. Cancer research shows both pro- and anti-tumor effects depending on context.

Risks & Safety Concerns

At high concentrations, LL-37 can be cytotoxic to host cells. Potential for pro-inflammatory effects in certain contexts. May promote tumor growth in some cancer types. Systemic administration carries risk of hemolysis and toxicity. Stability and delivery remain challenges for therapeutic development.

Regulatory & Legal Status

Research Only

LL-37 is available as a research peptide. It is not approved as a therapeutic by the FDA. Several clinical trials are ongoing or completed for specific applications.

Have questions about LL-37?

Ask our AI research assistant for educational information about this peptide.

Ask AI Assistant

Disclaimer

This platform is for educational and research purposes only. The information provided does not constitute medical advice, diagnosis, or treatment recommendations. Always consult a qualified healthcare professional before making any health-related decisions.

The authors and contributors of this platform are not medical professionals, licensed physicians, or pharmacists. The content presented herein has been compiled from publicly available research and peer-reviewed literature for informational purposes only. No information on this platform should be interpreted as a recommendation to buy, sell, or use any substance. Any decision to use peptides or related compounds should be made solely under the guidance of a qualified healthcare provider. We assume no liability for actions taken based on information provided on this platform.

This platform is for educational and research purposes only. The information provided does not constitute medical advice, diagnosis, or treatment recommendations. Always consult a qualified healthcare professional before making any health-related decisions.